Lineage for d1ce1l2 (1ce1 L:108-211)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2351429Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2351430Species Human (Homo sapiens) [TaxId:9606] [88569] (148 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2351448Domain d1ce1l2: 1ce1 L:108-211 [21310]
    Other proteins in same PDB: d1ce1h1, d1ce1h2, d1ce1h3, d1ce1l1
    part of humanized therapeutic antibody CAMPATH-1H

Details for d1ce1l2

PDB Entry: 1ce1 (more details), 1.9 Å

PDB Description: 1.9a structure of the therapeutic antibody campath-1h fab in complex with a synthetic peptide antigen
PDB Compounds: (L:) protein (campath-1h:light chain)

SCOPe Domain Sequences for d1ce1l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce1l2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d1ce1l2:

Click to download the PDB-style file with coordinates for d1ce1l2.
(The format of our PDB-style files is described here.)

Timeline for d1ce1l2: