SCOPe 2.05: Domain d3lxmb2: 3lxm B:152-309

Lineage for d3lxmb2 (3lxm B:152-309)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [225856] (1 PDB entry)

8. Domain d3lxmb2: 3lxm B:152-309 [213090]
   Other proteins in same PDB: d3lxma1, d3lxmb1, d3lxmc1
   automated match to d1ekxa2
   complexed with pg4

Details for d3lxmb2

PDB Entry: 3lxm, 2 Å

PDB Description: 2.00 angstrom resolution crystal structure of a catalytic subunit of an aspartate carbamoyltransferase (pyrb) from yersinia pestis co92

PDB Compounds: (B:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d3lxmb2:

Sequence, based on SEQRES records:

>d3lxmb2 c.78.1.0 (B:152-309) automated matches {Yersinia pestis [TaxId: 214092]}
rldniniamvgdlkygrtvhsltqalakfngnhfffiapdalampayilqmleekeieys
lhesleevvpeldilymtrvqkerldpseyanvkaqfilrssdltgardnlkvlhplpri
deittdvdktpyayyfqqagngifarqallalvlnael

Sequence, based on observed residues (ATOM records):

>d3lxmb2 c.78.1.0 (B:152-309) automated matches {Yersinia pestis [TaxId: 214092]}
rldniniamvgdlkygrtvhsltqalakfngnhfffiapdalampayilqmleekeieys
lhesleevvpeldilymtrqfilrssdltgardnlkvlhplprideittdvdktpyayyf
qqagngifarqallalvlnael

Timeline for d3lxmb2:

• d3lxmb2 first appeared in SCOPe 2.03
  
• d3lxmb2 appears in SCOPe 2.04
  
• d3lxmb2 appears in SCOPe 2.06
  
• d3lxmb2 appears in the current release, SCOPe 2.08