Lineage for d1bfoh2 (1bfo H:122-216)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549580Species Rat (Rattus norvegicus) [TaxId:10116] [88578] (4 PDB entries)
  8. 549586Domain d1bfoh2: 1bfo H:122-216 [21309]
    Other proteins in same PDB: d1bfoa1, d1bfoa2, d1bfob1, d1bfoc1, d1bfoc2, d1bfod1, d1bfoe1, d1bfoe2, d1bfof1, d1bfog1, d1bfog2, d1bfoh1
    part of therapeutic monoclonal antibody CAMPATH-1G

Details for d1bfoh2

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfoh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfoh2 b.1.1.2 (H:122-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Rat (Rattus norvegicus)}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdkkv

SCOP Domain Coordinates for d1bfoh2:

Click to download the PDB-style file with coordinates for d1bfoh2.
(The format of our PDB-style files is described here.)

Timeline for d1bfoh2: