| Class b: All beta proteins [48724] (141 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [88578] (4 PDB entries) |
| Domain d1bfoh2: 1bfo H:122-216 [21309] Other proteins in same PDB: d1bfoa1, d1bfoa2, d1bfob1, d1bfoc1, d1bfoc2, d1bfod1, d1bfoe1, d1bfoe2, d1bfof1, d1bfog1, d1bfog2, d1bfoh1 part of therapeutic monoclonal antibody CAMPATH-1G |
PDB Entry: 1bfo (more details), 2.6 Å
SCOP Domain Sequences for d1bfoh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfoh2 b.1.1.2 (H:122-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Rat (Rattus norvegicus)}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdkkv
Timeline for d1bfoh2: