SCOP 1.59: Domain d1bfoh2: 1bfo H:122-216

Lineage for d1bfoh2 (1bfo H:122-216)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain [49077] (1 PDB entry)

8. Domain d1bfoh2: 1bfo H:122-216 [21309]
   Other proteins in same PDB: d1bfoa1, d1bfob1, d1bfoc1, d1bfod1, d1bfoe1, d1bfof1, d1bfog1, d1bfoh1

Details for d1bfoh2

PDB Entry: 1bfo, 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfoh2:

Sequence; same for both SEQRES and ATOM records:

>d1bfoh2 b.1.1.2 (H:122-216) Immunoglobulin (constant domains of L and H chains) {CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdkkv

Timeline for d1bfoh2:

• d1bfoh2 first appeared (with stable ids) in SCOP 1.55
  
• d1bfoh2 appears in SCOP 1.57
  
• d1bfoh2 appears in SCOP 1.61
  
• d1bfoh2 appears in the current release, SCOPe 2.08