Lineage for d3lxma2 (3lxm A:152-310)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2907328Species Yersinia pestis [TaxId:214092] [225856] (1 PDB entry)
  8. 2907329Domain d3lxma2: 3lxm A:152-310 [213088]
    Other proteins in same PDB: d3lxma1, d3lxmb1, d3lxmc1
    automated match to d1ekxa2
    complexed with pg4

Details for d3lxma2

PDB Entry: 3lxm (more details), 2 Å

PDB Description: 2.00 angstrom resolution crystal structure of a catalytic subunit of an aspartate carbamoyltransferase (pyrb) from yersinia pestis co92
PDB Compounds: (A:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d3lxma2:

Sequence, based on SEQRES records: (download)

>d3lxma2 c.78.1.0 (A:152-310) automated matches {Yersinia pestis [TaxId: 214092]}
rldniniamvgdlkygrtvhsltqalakfngnhfffiapdalampayilqmleekeieys
lhesleevvpeldilymtrvqkerldpseyanvkaqfilrssdltgardnlkvlhplpri
deittdvdktpyayyfqqagngifarqallalvlnaela

Sequence, based on observed residues (ATOM records): (download)

>d3lxma2 c.78.1.0 (A:152-310) automated matches {Yersinia pestis [TaxId: 214092]}
rldniniamvgdlkygrtvhsltqalakfngnhfffiapdalampayilqmleekeieys
lhesleevvpeldilymtryanvkaqfilrssdltgardnlkvlhplprideittdvdkt
pyayyfqqagngifarqallalvlnaela

SCOPe Domain Coordinates for d3lxma2:

Click to download the PDB-style file with coordinates for d3lxma2.
(The format of our PDB-style files is described here.)

Timeline for d3lxma2: