![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
![]() | Protein automated matches [226938] (26 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:214092] [225856] (1 PDB entry) |
![]() | Domain d3lxma2: 3lxm A:152-310 [213088] Other proteins in same PDB: d3lxma1, d3lxmb1, d3lxmc1 automated match to d1ekxa2 complexed with pg4 |
PDB Entry: 3lxm (more details), 2 Å
SCOPe Domain Sequences for d3lxma2:
Sequence, based on SEQRES records: (download)
>d3lxma2 c.78.1.0 (A:152-310) automated matches {Yersinia pestis [TaxId: 214092]} rldniniamvgdlkygrtvhsltqalakfngnhfffiapdalampayilqmleekeieys lhesleevvpeldilymtrvqkerldpseyanvkaqfilrssdltgardnlkvlhplpri deittdvdktpyayyfqqagngifarqallalvlnaela
>d3lxma2 c.78.1.0 (A:152-310) automated matches {Yersinia pestis [TaxId: 214092]} rldniniamvgdlkygrtvhsltqalakfngnhfffiapdalampayilqmleekeieys lhesleevvpeldilymtryanvkaqfilrssdltgardnlkvlhplprideittdvdkt pyayyfqqagngifarqallalvlnaela
Timeline for d3lxma2:
![]() Domains from other chains: (mouse over for more information) d3lxmb1, d3lxmb2, d3lxmc1, d3lxmc2 |