SCOPe 2.08: Domain d3lwbb2: 3lwb B:151-373

Lineage for d3lwbb2 (3lwb B:151-373)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [225852] (1 PDB entry)

8. Domain d3lwbb2: 3lwb B:151-373 [213080]
   Other proteins in same PDB: d3lwba1, d3lwbb1
   automated match to d1ehib2
   complexed with no3

Details for d3lwbb2

PDB Entry: 3lwb, 2.1 Å

PDB Description: crystal structure of apo d-alanine:d-alanine ligase (ddl) from mycobacterium tuberculosis

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3lwbb2:

Sequence; same for both SEQRES and ATOM records:

>d3lwbb2 d.142.1.0 (B:151-373) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dkeftkkllaadglpvgayavlrpprstlhrqecerlglpvfvkparggssigvsrvssw
dqlpaavararrhdpkviveaaisgrelecgvlempdgtleastlgeirvagvrgredsf
ydfatkylddaaeldvpakvddqvaeairqlairafaaidcrglarvdffltddgpvine
intmpgfttismyprmwaasgvdyptllatmiettlargvglh

Timeline for d3lwbb2:

• d3lwbb2 first appeared in SCOPe 2.03
  
• d3lwbb2 appears in SCOPe 2.07