Lineage for d1bfog2 (1bfo G:108-214)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 366104Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (4 PDB entries)
  8. 366110Domain d1bfog2: 1bfo G:108-214 [21308]
    Other proteins in same PDB: d1bfoa1, d1bfob1, d1bfob2, d1bfoc1, d1bfod1, d1bfod2, d1bfoe1, d1bfof1, d1bfof2, d1bfog1, d1bfoh1, d1bfoh2
    part of therapeutic monoclonal antibody CAMPATH-1G

Details for d1bfog2

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfog2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfog2 b.1.1.2 (G:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus)}
ranaaptvsifppsteqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqds
adstysmsstlsltkadyqshnlytcqvvhktssspvvaknfnrnec

SCOP Domain Coordinates for d1bfog2:

Click to download the PDB-style file with coordinates for d1bfog2.
(The format of our PDB-style files is described here.)

Timeline for d1bfog2: