Lineage for d3lvba2 (3lvb A:157-316)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359066Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1359067Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 1359225Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 1359226Protein automated matches [226871] (12 species)
    not a true protein
  7. 1359251Species Maize (Zea mays) [TaxId:4577] [226538] (5 PDB entries)
  8. 1359255Domain d3lvba2: 3lvb A:157-316 [213074]
    Other proteins in same PDB: d3lvba1
    automated match to d1frna2
    complexed with fad

Details for d3lvba2

PDB Entry: 3lvb (more details), 1.7 Å

PDB Description: Crystal structure of the Ferredoxin:NADP+ reductase from maize root at 1.7 angstroms - Test Set Withheld
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d3lvba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lvba2 c.25.1.0 (A:157-316) automated matches {Maize (Zea mays) [TaxId: 4577]}
mllpeedpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllyd
eeftsylkqypdnfrydkalsreqknrsggkmyvqdkieeysdeifklldggahiyfcgl
kgmmpgiqdtlkkvaerrgeswdqklaqlkknkqwhvevy

SCOPe Domain Coordinates for d3lvba2:

Click to download the PDB-style file with coordinates for d3lvba2.
(The format of our PDB-style files is described here.)

Timeline for d3lvba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lvba1