SCOPe 2.08: Domain d3lvba2: 3lvb A:157-316

Lineage for d3lvba2 (3lvb A:157-316)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (19 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [226538] (17 PDB entries)

8. Domain d3lvba2: 3lvb A:157-316 [213074]
   Other proteins in same PDB: d3lvba1
   automated match to d1frna2
   complexed with fad

Details for d3lvba2

PDB Entry: 3lvb, 1.7 Å

PDB Description: Crystal structure of the Ferredoxin:NADP+ reductase from maize root at 1.7 angstroms - Test Set Withheld

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d3lvba2:

Sequence; same for both SEQRES and ATOM records:

>d3lvba2 c.25.1.0 (A:157-316) automated matches {Maize (Zea mays) [TaxId: 4577]}
mllpeedpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllyd
eeftsylkqypdnfrydkalsreqknrsggkmyvqdkieeysdeifklldggahiyfcgl
kgmmpgiqdtlkkvaerrgeswdqklaqlkknkqwhvevy

Timeline for d3lvba2:

• d3lvba2 first appeared in SCOPe 2.03
  
• d3lvba2 appears in SCOPe 2.07