| Class b: All beta proteins [48724] (180 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
| Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
| Protein automated matches [226870] (22 species) not a true protein |
| Species Maize (Zea mays) [TaxId:4577] [226539] (17 PDB entries) |
| Domain d3lvba1: 3lvb A:6-156 [213073] Other proteins in same PDB: d3lvba2 automated match to d1frna1 complexed with fad |
PDB Entry: 3lvb (more details), 1.7 Å
SCOPe Domain Sequences for d3lvba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lvba1 b.43.4.0 (A:6-156) automated matches {Maize (Zea mays) [TaxId: 4577]}
srskvsvaplhlesakepplntykpkepftativsveslvgpkapgetchividhggnvp
ywegqsygvippgenpkkpgapqnvrlysiastrygdnfdgrtgslcvrravyydpetgk
edpskngvcsnflcnskpgdkiqltgpsgki
Timeline for d3lvba1: