Lineage for d3lvba1 (3lvb A:6-156)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793672Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2793673Protein automated matches [226870] (22 species)
    not a true protein
  7. 2793731Species Maize (Zea mays) [TaxId:4577] [226539] (17 PDB entries)
  8. 2793735Domain d3lvba1: 3lvb A:6-156 [213073]
    Other proteins in same PDB: d3lvba2
    automated match to d1frna1
    complexed with fad

Details for d3lvba1

PDB Entry: 3lvb (more details), 1.7 Å

PDB Description: Crystal structure of the Ferredoxin:NADP+ reductase from maize root at 1.7 angstroms - Test Set Withheld
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d3lvba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lvba1 b.43.4.0 (A:6-156) automated matches {Maize (Zea mays) [TaxId: 4577]}
srskvsvaplhlesakepplntykpkepftativsveslvgpkapgetchividhggnvp
ywegqsygvippgenpkkpgapqnvrlysiastrygdnfdgrtgslcvrravyydpetgk
edpskngvcsnflcnskpgdkiqltgpsgki

SCOPe Domain Coordinates for d3lvba1:

Click to download the PDB-style file with coordinates for d3lvba1.
(The format of our PDB-style files is described here.)

Timeline for d3lvba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lvba2