Lineage for d3lv8a_ (3lv8 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2473889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2474437Protein automated matches [190087] (15 species)
    not a true protein
  7. 2474548Species Vibrio cholerae [TaxId:243277] [225848] (2 PDB entries)
  8. 2474549Domain d3lv8a_: 3lv8 A: [213072]
    automated match to d4tmka_
    complexed with adp, ca, cl, tmp, tyd

Details for d3lv8a_

PDB Entry: 3lv8 (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of a thymidylate kinase (tmk) from vibrio cholerae o1 biovar eltor str. n16961 in complex with tmp, thymidine-5'-diphosphate and adp
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d3lv8a_:

Sequence, based on SEQRES records: (download)

>d3lv8a_ c.37.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
nakfivieglegagkstaiqvvvetlqqngidhitrtrepggtllaeklralvkeehpge
elqditelllvyaarvqlvenvikpalargewvvgdrhdmssqayqgggrqiapstmqsl
kqtalgdfkpdltlyldidpklglerargrgeldriekmdisfferarerylelansdds
vvmidaaqsieqvtadirralqdwlsqvn

Sequence, based on observed residues (ATOM records): (download)

>d3lv8a_ c.37.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
nakfivieglegagkstaiqvvvetlqqngidhitrtrepggtllaeklralvkeehpge
elqditelllvyaarvqlvenvikpalargewvvgdrhdmssqayqgggrqiapstmqsl
kqtalgdfkpdltlyldidpklglereldriekmdisfferarerylelansddsvvmid
aaqsieqvtadirralqdwlsqvn

SCOPe Domain Coordinates for d3lv8a_:

Click to download the PDB-style file with coordinates for d3lv8a_.
(The format of our PDB-style files is described here.)

Timeline for d3lv8a_: