SCOPe 2.08: Domain d3lv8a_: 3lv8 A:

Lineage for d3lv8a_ (3lv8 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (15 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [225848] (2 PDB entries)

8. Domain d3lv8a_: 3lv8 A: [213072]
   automated match to d4tmka_
   complexed with adp, ca, cl, tmp, tyd

Details for d3lv8a_

PDB Entry: 3lv8, 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of a thymidylate kinase (tmk) from vibrio cholerae o1 biovar eltor str. n16961 in complex with tmp, thymidine-5'-diphosphate and adp

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d3lv8a_:

Sequence, based on SEQRES records:

>d3lv8a_ c.37.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
nakfivieglegagkstaiqvvvetlqqngidhitrtrepggtllaeklralvkeehpge
elqditelllvyaarvqlvenvikpalargewvvgdrhdmssqayqgggrqiapstmqsl
kqtalgdfkpdltlyldidpklglerargrgeldriekmdisfferarerylelansdds
vvmidaaqsieqvtadirralqdwlsqvn

Sequence, based on observed residues (ATOM records):

>d3lv8a_ c.37.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
nakfivieglegagkstaiqvvvetlqqngidhitrtrepggtllaeklralvkeehpge
elqditelllvyaarvqlvenvikpalargewvvgdrhdmssqayqgggrqiapstmqsl
kqtalgdfkpdltlyldidpklglereldriekmdisfferarerylelansddsvvmid
aaqsieqvtadirralqdwlsqvn

Timeline for d3lv8a_:

• d3lv8a_ first appeared in SCOPe 2.03
  
• d3lv8a_ appears in SCOPe 2.07