SCOPe 2.07: Domain d3lu7b1: 3lu7 B:4-196

Lineage for d3lu7b1 (3lu7 B:4-196)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (93 PDB entries)
   Uniprot P02768 29-596

8. Domain d3lu7b1: 3lu7 B:4-196 [213060]
   automated match to d1n5ua1
   complexed with ipx, po4

Details for d3lu7b1

PDB Entry: 3lu7, 2.8 Å

PDB Description: Human serum albumin in complex with compound 2

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d3lu7b1:

Sequence; same for both SEQRES and ATOM records:

>d3lu7b1 a.126.1.1 (B:4-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
ksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencd
kslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvm
ctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkld
elrdegkassakq

Timeline for d3lu7b1:

• d3lu7b1 first appeared in SCOPe 2.03
  
• d3lu7b1 appears in SCOPe 2.06
  
• d3lu7b1 appears in the current release, SCOPe 2.08