SCOP 1.67: Domain d1bfoe2: 1bfo E:108-214

Lineage for d1bfoe2 (1bfo E:108-214)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (4 PDB entries)

8. Domain d1bfoe2: 1bfo E:108-214 [21306]
   Other proteins in same PDB: d1bfoa1, d1bfob1, d1bfob2, d1bfoc1, d1bfod1, d1bfod2, d1bfoe1, d1bfof1, d1bfof2, d1bfog1, d1bfoh1, d1bfoh2

Details for d1bfoe2

PDB Entry: 1bfo, 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfoe2:

Sequence; same for both SEQRES and ATOM records:

>d1bfoe2 b.1.1.2 (E:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus)}
ranaaptvsifppsteqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqds
adstysmsstlsltkadyqshnlytcqvvhktssspvvaknfnrnec

Timeline for d1bfoe2:

• d1bfoe2 first appeared (with stable ids) in SCOP 1.55
  
• d1bfoe2 appears in SCOP 1.65
  
• d1bfoe2 appears in SCOP 1.69
  
• d1bfoe2 appears in the current release, SCOPe 2.08