![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (10 PDB entries) |
![]() | Domain d1bfoe2: 1bfo E:108-214 [21306] Other proteins in same PDB: d1bfoa1, d1bfob1, d1bfob2, d1bfoc1, d1bfod1, d1bfod2, d1bfoe1, d1bfof1, d1bfof2, d1bfog1, d1bfoh1, d1bfoh2 part of therapeutic monoclonal antibody CAMPATH-1G |
PDB Entry: 1bfo (more details), 2.6 Å
SCOPe Domain Sequences for d1bfoe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfoe2 b.1.1.2 (E:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]} ranaaptvsifppsteqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqds adstysmsstlsltkadyqshnlytcqvvhktssspvvaknfnrnec
Timeline for d1bfoe2: