Lineage for d1bfod2 (1bfo D:122-216)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655793Species Rat (Rattus norvegicus) [TaxId:10116] [88578] (4 PDB entries)
  8. 655797Domain d1bfod2: 1bfo D:122-216 [21305]
    Other proteins in same PDB: d1bfoa1, d1bfoa2, d1bfob1, d1bfoc1, d1bfoc2, d1bfod1, d1bfoe1, d1bfoe2, d1bfof1, d1bfog1, d1bfog2, d1bfoh1

Details for d1bfod2

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab
PDB Compounds: (D:) campath-1g antibody

SCOP Domain Sequences for d1bfod2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfod2 b.1.1.2 (D:122-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Rat (Rattus norvegicus) [TaxId: 10116]}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdkkv

SCOP Domain Coordinates for d1bfod2:

Click to download the PDB-style file with coordinates for d1bfod2.
(The format of our PDB-style files is described here.)

Timeline for d1bfod2: