Lineage for d3lu1c_ (3lu1 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091795Protein automated matches [190085] (51 species)
    not a true protein
  7. 2092063Species Plesiomonas shigelloides [TaxId:703] [189972] (9 PDB entries)
  8. 2092093Domain d3lu1c_: 3lu1 C: [213049]
    automated match to d3ruca_
    complexed with gly, na, nad, so4, ud2

Details for d3lu1c_

PDB Entry: 3lu1 (more details), 2.5 Å

PDB Description: crystal structure analysis of wbgu: a udp-galnac 4-epimerase
PDB Compounds: (C:) WbgU

SCOPe Domain Sequences for d3lu1c_:

Sequence, based on SEQRES records: (download)

>d3lu1c_ c.2.1.2 (C:) automated matches {Plesiomonas shigelloides [TaxId: 703]}
sryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldevkt
lvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnitgf
lnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvyar
tygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyidnv
iqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhidklsikyrefrsgd
vrhsqadvtkaidllkyrpnikireglrlsmpwyvrflk

Sequence, based on observed residues (ATOM records): (download)

>d3lu1c_ c.2.1.2 (C:) automated matches {Plesiomonas shigelloides [TaxId: 703]}
sryeeitqqlifspktwlitgvagfigsnllekllklnqvvigldnfstghqynldevkt
lvsteqwsrfcfiegdirdlttceqvmkgvdhvlhqaalgsvprsivdpittnatnitgf
lnilhaaknaqvqsftyaassstygdhpalpkveenignplspyavtkyvneiyaqvyar
tygfktiglryfnvfgrrqdpngayaavipkwtaamlkgddvyingdgetsrdfcyidnv
iqmnilsalakdsakdniynvavgdrttlnelsgyiydelnlihhikyrefrsgdvrhsq
advtkaidllkyrpnikireglrlsmpwyvrflk

SCOPe Domain Coordinates for d3lu1c_:

Click to download the PDB-style file with coordinates for d3lu1c_.
(The format of our PDB-style files is described here.)

Timeline for d3lu1c_: