| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (86 species) not a true protein |
| Species Bermanella marisrubri [TaxId:207949] [225858] (1 PDB entry) |
| Domain d3ltex_: 3lte X: [213042] Other proteins in same PDB: d3lted2, d3ltee2, d3ltef2, d3lteg2, d3lteh2, d3ltei2, d3ltep2 automated match to d1nxoa_ complexed with gol, po4 |
PDB Entry: 3lte (more details), 2 Å
SCOPe Domain Sequences for d3ltex_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ltex_ c.23.1.0 (X:) automated matches {Bermanella marisrubri [TaxId: 207949]}
skrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldg
ldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlv
Timeline for d3ltex_:
View in 3DDomains from other chains: (mouse over for more information) d3ltea_, d3lteb_, d3ltec_, d3lted1, d3lted2, d3ltee1, d3ltee2, d3ltef1, d3ltef2, d3lteg1, d3lteg2, d3lteh1, d3lteh2, d3ltei1, d3ltei2, d3ltej_, d3ltek_, d3ltel_, d3ltem_, d3lten_, d3lteo_, d3ltep1, d3ltep2, d3lteq_, d3lter_, d3ltes_, d3ltet_, d3lteu_, d3ltev_, d3ltew_ |