Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (59 species) not a true protein |
Species Bermanella marisrubri [TaxId:207949] [225858] (1 PDB entry) |
Domain d3ltev_: 3lte V: [213040] automated match to d1nxoa_ complexed with gol, po4 |
PDB Entry: 3lte (more details), 2 Å
SCOPe Domain Sequences for d3ltev_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ltev_ c.23.1.0 (V:) automated matches {Bermanella marisrubri [TaxId: 207949]} skrilvvdddqamaaaiervlkrdhwqveiahngfdagiklstfepaimtldlsmpkldg ldvirslrqnkvanqpkilvvsgldkaklqqavtegaddylekpfdndalldrihdlv
Timeline for d3ltev_: