Lineage for d1bfoc2 (1bfo C:108-214)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289993Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (4 PDB entries)
  8. 289999Domain d1bfoc2: 1bfo C:108-214 [21304]
    Other proteins in same PDB: d1bfoa1, d1bfob1, d1bfob2, d1bfoc1, d1bfod1, d1bfod2, d1bfoe1, d1bfof1, d1bfof2, d1bfog1, d1bfoh1, d1bfoh2

Details for d1bfoc2

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfoc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfoc2 b.1.1.2 (C:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus)}
ranaaptvsifppsteqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqds
adstysmsstlsltkadyqshnlytcqvvhktssspvvaknfnrnec

SCOP Domain Coordinates for d1bfoc2:

Click to download the PDB-style file with coordinates for d1bfoc2.
(The format of our PDB-style files is described here.)

Timeline for d1bfoc2: