Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (6 PDB entries) |
Domain d1bfoa2: 1bfo A:108-214 [21302] Other proteins in same PDB: d1bfoa1, d1bfob1, d1bfob2, d1bfoc1, d1bfod1, d1bfod2, d1bfoe1, d1bfof1, d1bfof2, d1bfog1, d1bfoh1, d1bfoh2 part of therapeutic monoclonal antibody CAMPATH-1G |
PDB Entry: 1bfo (more details), 2.6 Å
SCOPe Domain Sequences for d1bfoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfoa2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]} ranaaptvsifppsteqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqds adstysmsstlsltkadyqshnlytcqvvhktssspvvaknfnrnec
Timeline for d1bfoa2: