Lineage for d1bfoa2 (1bfo A:108-214)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 934293Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 934944Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (6 PDB entries)
  8. 934947Domain d1bfoa2: 1bfo A:108-214 [21302]
    Other proteins in same PDB: d1bfoa1, d1bfob1, d1bfob2, d1bfoc1, d1bfod1, d1bfod2, d1bfoe1, d1bfof1, d1bfof2, d1bfog1, d1bfoh1, d1bfoh2
    part of therapeutic monoclonal antibody CAMPATH-1G

Details for d1bfoa2

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab
PDB Compounds: (A:) campath-1g antibody

SCOPe Domain Sequences for d1bfoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfoa2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ranaaptvsifppsteqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqds
adstysmsstlsltkadyqshnlytcqvvhktssspvvaknfnrnec

SCOPe Domain Coordinates for d1bfoa2:

Click to download the PDB-style file with coordinates for d1bfoa2.
(The format of our PDB-style files is described here.)

Timeline for d1bfoa2: