![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
![]() | Protein automated matches [226860] (38 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226081] (2 PDB entries) |
![]() | Domain d3lsud2: 3lsu D:91-207 [213018] Other proteins in same PDB: d3lsua1, d3lsub1, d3lsuc1, d3lsud1 automated match to d1kkca2 complexed with gol, mn, na |
PDB Entry: 3lsu (more details), 1.9 Å
SCOPe Domain Sequences for d3lsud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lsud2 d.44.1.0 (D:91-207) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq tynqdtvtgplvplvaidawehayylqyqnkkadyfkaiwnvvnwkeasrrfdagki
Timeline for d3lsud2: