Lineage for d3lsud1 (3lsu D:1-90)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690394Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226080] (2 PDB entries)
  8. 2690402Domain d3lsud1: 3lsu D:1-90 [213017]
    Other proteins in same PDB: d3lsua2, d3lsub2, d3lsuc2, d3lsud2
    automated match to d1kkca1
    complexed with gol, mn, na

Details for d3lsud1

PDB Entry: 3lsu (more details), 1.9 Å

PDB Description: crystal structure of sod2 from saccharomyces cerevisiae
PDB Compounds: (D:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d3lsud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lsud1 a.2.11.0 (D:1-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
arkmiaiqqnikfhgggftnhclfwenlap

SCOPe Domain Coordinates for d3lsud1:

Click to download the PDB-style file with coordinates for d3lsud1.
(The format of our PDB-style files is described here.)

Timeline for d3lsud1: