Lineage for d3lsuc2 (3lsu C:91-206)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411453Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1411454Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1411726Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1411727Protein automated matches [226860] (25 species)
    not a true protein
  7. 1411753Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226081] (2 PDB entries)
  8. 1411756Domain d3lsuc2: 3lsu C:91-206 [213016]
    Other proteins in same PDB: d3lsua1, d3lsub1, d3lsuc1, d3lsud1
    automated match to d1kkca2
    complexed with gol, mn, na

Details for d3lsuc2

PDB Entry: 3lsu (more details), 1.9 Å

PDB Description: crystal structure of sod2 from saccharomyces cerevisiae
PDB Compounds: (C:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d3lsuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lsuc2 d.44.1.0 (C:91-206) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq
tynqdtvtgplvplvaidawehayylqyqnkkadyfkaiwnvvnwkeasrrfdagk

SCOPe Domain Coordinates for d3lsuc2:

Click to download the PDB-style file with coordinates for d3lsuc2.
(The format of our PDB-style files is described here.)

Timeline for d3lsuc2: