SCOPe 2.08: Domain d3lsuc2: 3lsu C:91-206

Lineage for d3lsuc2 (3lsu C:91-206)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226081] (2 PDB entries)

8. Domain d3lsuc2: 3lsu C:91-206 [213016]
   Other proteins in same PDB: d3lsua1, d3lsub1, d3lsuc1, d3lsud1
   automated match to d1kkca2
   complexed with gol, mn, na

Details for d3lsuc2

PDB Entry: 3lsu, 1.9 Å

PDB Description: crystal structure of sod2 from saccharomyces cerevisiae

PDB Compounds: (C:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d3lsuc2:

Sequence; same for both SEQRES and ATOM records:

>d3lsuc2 d.44.1.0 (C:91-206) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq
tynqdtvtgplvplvaidawehayylqyqnkkadyfkaiwnvvnwkeasrrfdagk

Timeline for d3lsuc2:

• d3lsuc2 first appeared in SCOPe 2.03
  
• d3lsuc2 appears in SCOPe 2.07