Lineage for d3lsuc1 (3lsu C:1-90)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1719057Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1719324Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1719325Protein automated matches [226859] (31 species)
    not a true protein
  7. 1719368Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226080] (2 PDB entries)
  8. 1719371Domain d3lsuc1: 3lsu C:1-90 [213015]
    Other proteins in same PDB: d3lsua2, d3lsub2, d3lsuc2, d3lsud2
    automated match to d1kkca1
    complexed with gol, mn, na

Details for d3lsuc1

PDB Entry: 3lsu (more details), 1.9 Å

PDB Description: crystal structure of sod2 from saccharomyces cerevisiae
PDB Compounds: (C:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d3lsuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lsuc1 a.2.11.0 (C:1-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
arkmiaiqqnikfhgggftnhclfwenlap

SCOPe Domain Coordinates for d3lsuc1:

Click to download the PDB-style file with coordinates for d3lsuc1.
(The format of our PDB-style files is described here.)

Timeline for d3lsuc1: