SCOPe 2.08: Domain d3lsuc1: 3lsu C:1-90

Lineage for d3lsuc1 (3lsu C:1-90)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226080] (2 PDB entries)

8. Domain d3lsuc1: 3lsu C:1-90 [213015]
   Other proteins in same PDB: d3lsua2, d3lsub2, d3lsuc2, d3lsud2
   automated match to d1kkca1
   complexed with gol, mn, na

Details for d3lsuc1

PDB Entry: 3lsu, 1.9 Å

PDB Description: crystal structure of sod2 from saccharomyces cerevisiae

PDB Compounds: (C:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d3lsuc1:

Sequence; same for both SEQRES and ATOM records:

>d3lsuc1 a.2.11.0 (C:1-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
arkmiaiqqnikfhgggftnhclfwenlap

Timeline for d3lsuc1:

• d3lsuc1 first appeared in SCOPe 2.03
  
• d3lsuc1 appears in SCOPe 2.07