Lineage for d3lsua2 (3lsu A:91-206)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189807Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2189808Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2190092Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2190093Protein automated matches [226860] (31 species)
    not a true protein
  7. 2190134Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226081] (2 PDB entries)
  8. 2190135Domain d3lsua2: 3lsu A:91-206 [213012]
    Other proteins in same PDB: d3lsua1, d3lsub1, d3lsuc1, d3lsud1
    automated match to d1kkca2
    complexed with gol, mn, na

Details for d3lsua2

PDB Entry: 3lsu (more details), 1.9 Å

PDB Description: crystal structure of sod2 from saccharomyces cerevisiae
PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d3lsua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lsua2 d.44.1.0 (A:91-206) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq
tynqdtvtgplvplvaidawehayylqyqnkkadyfkaiwnvvnwkeasrrfdagk

SCOPe Domain Coordinates for d3lsua2:

Click to download the PDB-style file with coordinates for d3lsua2.
(The format of our PDB-style files is described here.)

Timeline for d3lsua2: