SCOP 1.67: Domain d1b4jh2: 1b4j H:118-220

Lineage for d1b4jh2 (1b4j H:118-220)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1b4jh2: 1b4j H:118-220 [21301]
   Other proteins in same PDB: d1b4jh1, d1b4jl1, d1b4jl2
   part of a chimeric anti-gamma-interferon Fab

Details for d1b4jh2

PDB Entry: 1b4j, 2.9 Å

PDB Description: comparison of the three-dimensional structures of a humanized and a chimeric fab of an anti-gamma-interferon antibody

SCOP Domain Sequences for d1b4jh2:

Sequence; same for both SEQRES and ATOM records:

>d1b4jh2 b.1.1.2 (H:118-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1b4jh2:

• d1b4jh2 first appeared (with stable ids) in SCOP 1.55
  
• d1b4jh2 appears in SCOP 1.65
  
• d1b4jh2 appears in SCOP 1.69
  
• d1b4jh2 appears in the current release, SCOPe 2.08