Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Thermoplasma volcanium [TaxId:50339] [226070] (3 PDB entries) |
Domain d3lrtb1: 3lrt B:1-155 [213001] automated match to d1dkua1 complexed with adp, so4 |
PDB Entry: 3lrt (more details), 1.53 Å
SCOPe Domain Sequences for d3lrtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lrtb1 c.61.1.0 (B:1-155) automated matches {Thermoplasma volcanium [TaxId: 50339]} mkiialrsslklaariaeelktepvmpderrfpdgelylrydedltghnifiignthsda evmemiltlsaiqdyrtksvniiapyygyarqhqrykngepissqilteiyssysnsiat vdihdektlsyskvkfsdlhandaivryyknvdvd
Timeline for d3lrtb1: