SCOPe 2.03: Domain d3lrsl2: 3lrs L:108-209

Lineage for d3lrsl2 (3lrs L:108-209)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (12 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
Domain d3lrsl2: 3lrs L:108-209 [212998]
Other proteins in same PDB: d3lrsb1, d3lrsd1, d3lrsf1, d3lrsl1
automated match to d1jvka2
complexed with nag

Details for d3lrsl2

PDB Entry: 3lrs (more details), 2.37 Å

PDB Description: structure of pg16, an antibody with broad and potent neutralization of hiv-1

PDB Compounds: (L:) PG-16 Light Chain Fab

SCOPe Domain Sequences for d3lrsl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lrsl2 b.1.1.2 (L:108-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapt

SCOPe Domain Coordinates for d3lrsl2:

Click to download the PDB-style file with coordinates for d3lrsl2.
(The format of our PDB-style files is described here.)

Timeline for d3lrsl2: