SCOPe 2.08: Domain d3lrsf1: 3lrs F:3-107

Lineage for d3lrsf1 (3lrs F:3-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3lrsf1: 3lrs F:3-107 [212995]
   Other proteins in same PDB: d3lrsa_, d3lrsb2, d3lrsc_, d3lrsd2, d3lrse_, d3lrsf2, d3lrsh_, d3lrsl2
   automated match to d1lgva1
   complexed with nag

Details for d3lrsf1

PDB Entry: 3lrs, 2.37 Å

PDB Description: structure of pg16, an antibody with broad and potent neutralization of hiv-1

PDB Compounds: (F:) PG-16 Light Chain Fab

SCOPe Domain Sequences for d3lrsf1:

Sequence; same for both SEQRES and ATOM records:

>d3lrsf1 b.1.1.0 (F:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgisn
rfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlg

Timeline for d3lrsf1:

• d3lrsf1 first appeared in SCOPe 2.03
  
• d3lrsf1 appears in SCOPe 2.07