Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (23 species) not a true protein |
Species Xanthomonas oryzae [TaxId:291331] [226076] (2 PDB entries) |
Domain d3lpsa2: 3lps A:261-422 [212988] Other proteins in same PDB: d3lpsa1 automated match to d1s16a1 complexed with nov |
PDB Entry: 3lps (more details), 2.29 Å
SCOPe Domain Sequences for d3lpsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lpsa2 d.14.1.0 (A:261-422) automated matches {Xanthomonas oryzae [TaxId: 291331]} nglrdylkgemaehemlpadlfvgslkkdteivdwaagwvpegelvqesyvnliptaqhg thvnglrsgltdalrefcdfrnllprgvklapedvwdrvtfvlslkmtdpqfsgqtkerl ssrqaagfiegaahdafslylnqnveigekiaqiaidrasar
Timeline for d3lpsa2: