Lineage for d3lpsa1 (3lps A:59-260)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924588Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1924589Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1925132Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1925133Protein automated matches [226867] (13 species)
    not a true protein
  7. 1925250Species Xanthomonas oryzae [TaxId:291331] [226075] (2 PDB entries)
  8. 1925252Domain d3lpsa1: 3lps A:59-260 [212987]
    Other proteins in same PDB: d3lpsa2
    automated match to d1s16a2
    complexed with nov

Details for d3lpsa1

PDB Entry: 3lps (more details), 2.29 Å

PDB Description: Crystal structure of parE
PDB Compounds: (A:) Topoisomerase IV subunit B

SCOPe Domain Sequences for d3lpsa1:

Sequence, based on SEQRES records: (download)

>d3lpsa1 d.122.1.0 (A:59-260) automated matches {Xanthomonas oryzae [TaxId: 291331]}
gldpvkrrpgmytdtarpnhlaqevidnsvdealaghakqievtlykdgscevsddgrgm
pvdihpeekipgveliltrlhaggkfnnrnytfsgglhgvgvsvvnalstkvelfikreg
sehrmefrdgnaasklevvgtvgkkntgtrlrfwadpkyfdtpkfnvralrhllrakavl
cpgltvklhdeatgeqdswyfe

Sequence, based on observed residues (ATOM records): (download)

>d3lpsa1 d.122.1.0 (A:59-260) automated matches {Xanthomonas oryzae [TaxId: 291331]}
gldpvkrrpgmytdtarpnhlaqevidnsvdealaghakqievtlykdgscevsddgrgm
pvdihpeekipgveliltrlhgvgvsvvnalstkvelfikregsehrmefrdgnaaskle
vvgtvgkkntgtrlrfwadpkyfdtpkfnvralrhllrakavlcpgltvklhdeatgeqd
swyfe

SCOPe Domain Coordinates for d3lpsa1:

Click to download the PDB-style file with coordinates for d3lpsa1.
(The format of our PDB-style files is described here.)

Timeline for d3lpsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lpsa2