SCOPe 2.03: Domain d3lpnb2: 3lpn B:156-286

Lineage for d3lpnb2 (3lpn B:156-286)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (18 species)
   not a true protein

7. Species Thermoplasma volcanium [TaxId:50339] [226070] (3 PDB entries)

8. Domain d3lpnb2: 3lpn B:156-286 [212986]
   automated match to d1dkra2
   complexed with apc, so4

Details for d3lpnb2

PDB Entry: 3lpn, 1.8 Å

PDB Description: crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp).

PDB Compounds: (B:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d3lpnb2:

Sequence; same for both SEQRES and ATOM records:

>d3lpnb2 c.61.1.0 (B:156-286) automated matches {Thermoplasma volcanium [TaxId: 50339]}
yvvspddgglarvadisaklgkkhffiekkriddrtvemkvpnvdvngkkllivddiist
ggtiakssgllrekgaskiyvsavhglfvngsenkilqnadeihvtdtveskfsdisvyq
evcnyirdida

Timeline for d3lpnb2:

• d3lpnb2 is new in SCOPe 2.03-stable
  
• d3lpnb2 appears in SCOPe 2.04
  
• d3lpnb2 appears in the current release, SCOPe 2.08