Lineage for d3lpnb1 (3lpn B:1-155)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892123Species Thermoplasma volcanium [TaxId:50339] [226070] (3 PDB entries)
  8. 2892138Domain d3lpnb1: 3lpn B:1-155 [212985]
    automated match to d1dkua1
    complexed with apc, so4

Details for d3lpnb1

PDB Entry: 3lpn (more details), 1.8 Å

PDB Description: crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp).
PDB Compounds: (B:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d3lpnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lpnb1 c.61.1.0 (B:1-155) automated matches {Thermoplasma volcanium [TaxId: 50339]}
mkiialrsslklaariaeelktepvmpderrfpdgelylrydedltghnifiignthsda
evmemiltlsaiqdyrtksvniiapyygyarqhqrykngepissqilteiyssysnsiat
vdihdektlsyskvkfsdlhandaivryyknvdvd

SCOPe Domain Coordinates for d3lpnb1:

Click to download the PDB-style file with coordinates for d3lpnb1.
(The format of our PDB-style files is described here.)

Timeline for d3lpnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lpnb2