![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
![]() | Protein automated matches [190891] (38 species) not a true protein |
![]() | Species Thermoplasma volcanium [TaxId:50339] [226070] (3 PDB entries) |
![]() | Domain d3lpnb1: 3lpn B:1-155 [212985] automated match to d1dkua1 complexed with apc, so4 |
PDB Entry: 3lpn (more details), 1.8 Å
SCOPe Domain Sequences for d3lpnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lpnb1 c.61.1.0 (B:1-155) automated matches {Thermoplasma volcanium [TaxId: 50339]} mkiialrsslklaariaeelktepvmpderrfpdgelylrydedltghnifiignthsda evmemiltlsaiqdyrtksvniiapyygyarqhqrykngepissqilteiyssysnsiat vdihdektlsyskvkfsdlhandaivryyknvdvd
Timeline for d3lpnb1: