![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88569] (78 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
![]() | Domain d1b2wl2: 1b2w L:108-214 [21298] Other proteins in same PDB: d1b2wh1, d1b2wh2, d1b2wl1 part of a humanized anti-gamma-interferon Fab |
PDB Entry: 1b2w (more details), 2.9 Å
SCOP Domain Sequences for d1b2wl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b2wl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1b2wl2: