Lineage for d3lo0a_ (3lo0 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2052342Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2052479Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 2052480Protein automated matches [190523] (11 species)
    not a true protein
  7. 2052511Species Ehrlichia chaffeensis [TaxId:205920] [225838] (1 PDB entry)
  8. 2052512Domain d3lo0a_: 3lo0 A: [212978]
    automated match to d2eipa_
    complexed with so4

Details for d3lo0a_

PDB Entry: 3lo0 (more details), 1.95 Å

PDB Description: Crystal structure of inorganic pyrophosphatase from Ehrlichia chaffeensis
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3lo0a_:

Sequence, based on SEQRES records: (download)

>d3lo0a_ b.40.5.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
dnvtggdnvpkeinviieisqnscpvkyefdkeknlfcvdrflptsmyypcnygfiphtc
agdgdpvdvlvasrfpvmsgavirarpvgvlvmhdesgedvkilavpthkvdqyynnikd
ysdfpvsflnsishfftfykkleedkfvsvegwkdvtvaeklilsal

Sequence, based on observed residues (ATOM records): (download)

>d3lo0a_ b.40.5.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
dnvtggdnvpkeinviieisqnscpvkyefdkeknlfcvdrflptsmyypcnygfiphtc
agdgdpvdvlvasrfpvmsgavirarpvgvlvmhdedvkilavpthkvdqyynnikdysd
fpvsflnsishfftfyvsvegwkdvtvaeklilsal

SCOPe Domain Coordinates for d3lo0a_:

Click to download the PDB-style file with coordinates for d3lo0a_.
(The format of our PDB-style files is described here.)

Timeline for d3lo0a_: