SCOPe 2.06: Domain d3lnua2: 3lnu A:261-422

Lineage for d3lnua2 (3lnu A:261-422)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (17 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:291331] [226076] (2 PDB entries)

8. Domain d3lnua2: 3lnu A:261-422 [212977]
   Other proteins in same PDB: d3lnua1
   automated match to d1s16a1

Details for d3lnua2

PDB Entry: 3lnu, 2.2 Å

PDB Description: Crystal structure of ParE subunit

PDB Compounds: (A:) Topoisomerase IV subunit B

SCOPe Domain Sequences for d3lnua2:

Sequence; same for both SEQRES and ATOM records:

>d3lnua2 d.14.1.0 (A:261-422) automated matches {Xanthomonas oryzae [TaxId: 291331]}
nglrdylkgemaehemlpadlfvgslkkdteivdwaagwvpegelvqesyvnliptaqhg
thvnglrsgltdalrefcdfrnllprgvklapedvwdrvtfvlslkmtdpqfsgqtkerl
ssrqaagfiegaahdafslylnqnveigekiaqiaidrasar

Timeline for d3lnua2:

• d3lnua2 first appeared in SCOPe 2.03
  
• d3lnua2 appears in SCOPe 2.05
  
• d3lnua2 appears in SCOPe 2.07
  
• d3lnua2 appears in the current release, SCOPe 2.08