Lineage for d3lnia2 (3lni A:102-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763415Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2763423Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 2763446Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)
  8. 2763454Domain d3lnia2: 3lni A:102-213 [212973]
    automated match to d1ncja2
    complexed with ca

Details for d3lnia2

PDB Entry: 3lni (more details), 2.3 Å

PDB Description: crystal structure of e-cadherin ec12 e89a
PDB Compounds: (A:) Cadherin-1

SCOPe Domain Sequences for d3lnia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lnia2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn
mftvnrdtgvisvltsgldresyptytlvvqaadlqgeglsttakavitvkd

SCOPe Domain Coordinates for d3lnia2:

Click to download the PDB-style file with coordinates for d3lnia2.
(The format of our PDB-style files is described here.)

Timeline for d3lnia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lnia1