SCOPe 2.08: Domain d3lnhb2: 3lnh B:102-213

Lineage for d3lnhb2 (3lnh B:102-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)

8. Domain d3lnhb2: 3lnh B:102-213 [212971]
   automated match to d1ncja2
   complexed with ca

Details for d3lnhb2

PDB Entry: 3lnh, 2.6 Å

PDB Description: crystal structure of e-cadherin ec12 w2a

PDB Compounds: (B:) Cadherin-1

SCOPe Domain Sequences for d3lnhb2:

Sequence; same for both SEQRES and ATOM records:

>d3lnhb2 b.1.6.1 (B:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn
mftvnrdtgvisvltsgldresyptytlvvqaadlqgeglsttakavitvkd

Timeline for d3lnhb2:

• d3lnhb2 first appeared in SCOPe 2.03
  
• d3lnhb2 appears in SCOPe 2.07