Lineage for d3lnhb1 (3lnh B:5-101)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1298299Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1298300Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1298308Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 1298323Species Mouse (Mus musculus) [TaxId:10090] [49318] (13 PDB entries)
  8. 1298341Domain d3lnhb1: 3lnh B:5-101 [212970]
    automated match to d1ncja1
    complexed with ca

Details for d3lnhb1

PDB Entry: 3lnh (more details), 2.6 Å

PDB Description: crystal structure of e-cadherin ec12 w2a
PDB Compounds: (B:) Cadherin-1

SCOPe Domain Sequences for d3lnhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lnhb1 b.1.6.1 (B:5-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
ppiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlkvtq
pldreaiakyilyshavssngeavedpmeivitvtdq

SCOPe Domain Coordinates for d3lnhb1:

Click to download the PDB-style file with coordinates for d3lnhb1.
(The format of our PDB-style files is described here.)

Timeline for d3lnhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lnhb2