SCOPe 2.05: Domain d3lnha1: 3lnh A:5-101

Lineage for d3lnha1 (3lnh A:5-101)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.1: Cadherin [49314] (3 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)

8. Domain d3lnha1: 3lnh A:5-101 [212968]
   automated match to d1ncja1
   complexed with ca

Details for d3lnha1

PDB Entry: 3lnh, 2.6 Å

PDB Description: crystal structure of e-cadherin ec12 w2a

PDB Compounds: (A:) Cadherin-1

SCOPe Domain Sequences for d3lnha1:

Sequence; same for both SEQRES and ATOM records:

>d3lnha1 b.1.6.1 (A:5-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
ppiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlkvtq
pldreaiakyilyshavssngeavedpmeivitvtdq

Timeline for d3lnha1:

• d3lnha1 first appeared in SCOPe 2.03
  
• d3lnha1 appears in SCOPe 2.04
  
• d3lnha1 appears in SCOPe 2.06
  
• d3lnha1 appears in the current release, SCOPe 2.08