Lineage for d3lngb2 (3lng B:102-213)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037192Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2037193Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2037201Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 2037224Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)
  8. 2037251Domain d3lngb2: 3lng B:102-213 [212967]
    automated match to d1ncja2
    complexed with ca

Details for d3lngb2

PDB Entry: 3lng (more details), 2.7 Å

PDB Description: Crystal structure of E-cadherin EC12 AA extension
PDB Compounds: (B:) Cadherin-1

SCOPe Domain Sequences for d3lngb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lngb2 b.1.6.1 (B:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn
mftvnrdtgvisvltsgldresyptytlvvqaadlqgeglsttakavitvkd

SCOPe Domain Coordinates for d3lngb2:

Click to download the PDB-style file with coordinates for d3lngb2.
(The format of our PDB-style files is described here.)

Timeline for d3lngb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lngb1