SCOPe 2.08: Domain d3lngb1: 3lng B:2-101

Lineage for d3lngb1 (3lng B:2-101)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)

8. Domain d3lngb1: 3lng B:2-101 [212966]
   automated match to d1ncja1
   complexed with ca

Details for d3lngb1

PDB Entry: 3lng, 2.7 Å

PDB Description: Crystal structure of E-cadherin EC12 AA extension

PDB Compounds: (B:) Cadherin-1

SCOPe Domain Sequences for d3lngb1:

Sequence; same for both SEQRES and ATOM records:

>d3lngb1 b.1.6.1 (B:2-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
wvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlk
vtqpldreaiakyilyshavssngeavedpmeivitvtdq

Timeline for d3lngb1:

• d3lngb1 first appeared in SCOPe 2.03
  
• d3lngb1 appears in SCOPe 2.07