SCOP 1.75: Domain d1axtl2: 1axt L:108-211

Lineage for d1axtl2 (1axt L:108-211)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (318 PDB entries)
   Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity
   SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region)
   Uniprot P01837 # KAC_MOUSE Ig kappa chain C region
   Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region
   SQ NA # part of Fab 28 against HIV-1 RT
   Uniprot P01837 #
   KAC_MOUSE Ig kappa chain C region
   Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

8. Domain d1axtl2: 1axt L:108-211 [21296]
   Other proteins in same PDB: d1axth1, d1axth2, d1axtl1
   part of catalytic Fab 33F12 with an aldolase activity

Details for d1axtl2

PDB Entry: 1axt, 2.15 Å

PDB Description: immune versus natural selection: antibody aldolases with the rates of natural enzymes

PDB Compounds: (L:) immunoglobulin igg2a

SCOP Domain Sequences for d1axtl2:

Sequence; same for both SEQRES and ATOM records:

>d1axtl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1axtl2:

• d1axtl2 first appeared (with stable ids) in SCOP 1.55
  
• d1axtl2 appears in SCOP 1.73
  
• d1axtl2 appears in SCOPe 2.01
  
• d1axtl2 appears in the current release, SCOPe 2.08