SCOPe 2.06: Domain d3lnea1: 3lne A:1-101

Lineage for d3lnea1 (3lne A:1-101)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)

8. Domain d3lnea1: 3lne A:1-101 [212958]
   automated match to d1ncja1
   complexed with ca, gol

Details for d3lnea1

PDB Entry: 3lne, 2 Å

PDB Description: crystal structure of e-cadherin ec12 k14e

PDB Compounds: (A:) Cadherin-1

SCOPe Domain Sequences for d3lnea1:

Sequence; same for both SEQRES and ATOM records:

>d3lnea1 b.1.6.1 (A:1-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
dwvippiscpeneegefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwl
kvtqpldreaiakyilyshavssngeavedpmeivitvtdq

Timeline for d3lnea1:

• d3lnea1 first appeared in SCOPe 2.03
  
• d3lnea1 appears in SCOPe 2.05
  
• d3lnea1 appears in SCOPe 2.07
  
• d3lnea1 appears in the current release, SCOPe 2.08