SCOPe 2.03: Domain d3lndd2: 3lnd D:100-207

Lineage for d3lndd2 (3lnd D:100-207)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187373] (6 PDB entries)

8. Domain d3lndd2: 3lnd D:100-207 [212957]
   automated match to d1ncja2
   complexed with ca

Details for d3lndd2

PDB Entry: 3lnd, 2.82 Å

PDB Description: crystal structure of cadherin-6 ec12 w4a

PDB Compounds: (D:) Cdh6 protein

SCOPe Domain Sequences for d3lndd2:

Sequence, based on SEQRES records:

>d3lndd2 b.1.6.0 (D:100-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ndnepiftkdvytatvpemadvgtfvvqvtatdaddptygnsakvvysilqgqpyfsves
etgiiktallnmdrenreqyqvviqakdmggqmgglsgtttvnitltd

Sequence, based on observed residues (ATOM records):

>d3lndd2 b.1.6.0 (D:100-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ndnepiftkdvytatvpemadvgtfvvqvtatdaddptygnsakvvysilqgqpyfsves
etgiiktallnreqyqvviqakdmggqmgglsgtttvnitltd

Timeline for d3lndd2:

• d3lndd2 is new in SCOPe 2.03-stable
  
• d3lndd2 appears in SCOPe 2.04
  
• d3lndd2 appears in the current release, SCOPe 2.08