| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (3 families) ![]() |
| Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
| Protein automated matches [190458] (3 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [187373] (6 PDB entries) |
| Domain d3lndd2: 3lnd D:100-207 [212957] automated match to d1ncja2 complexed with ca |
PDB Entry: 3lnd (more details), 2.82 Å
SCOPe Domain Sequences for d3lndd2:
Sequence, based on SEQRES records: (download)
>d3lndd2 b.1.6.0 (D:100-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ndnepiftkdvytatvpemadvgtfvvqvtatdaddptygnsakvvysilqgqpyfsves
etgiiktallnmdrenreqyqvviqakdmggqmgglsgtttvnitltd
>d3lndd2 b.1.6.0 (D:100-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ndnepiftkdvytatvpemadvgtfvvqvtatdaddptygnsakvvysilqgqpyfsves
etgiiktallnreqyqvviqakdmggqmgglsgtttvnitltd
Timeline for d3lndd2: