SCOPe 2.08: Domain d3lndd1: 3lnd D:1-99

Lineage for d3lndd1 (3lnd D:1-99)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.6: Cadherin-like [49313] (4 families)
Family b.1.6.0: automated matches [191376] (1 protein)
not a true family
Protein automated matches [190458] (4 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries)
Domain d3lndd1: 3lnd D:1-99 [212956]
automated match to d1ncja1
complexed with ca

Details for d3lndd1

PDB Entry: 3lnd (more details), 2.82 Å

PDB Description: crystal structure of cadherin-6 ec12 w4a

PDB Compounds: (D:) Cdh6 protein

SCOPe Domain Sequences for d3lndd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lndd1 b.1.6.0 (D:1-99) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
swmanqfflleeytgsdyqyvgklhsdqdrgdgslkyilsgdgagdlfiinentgdiqat
krldreekpvyilraqavnrrtgrpvepesefiikihdi

SCOPe Domain Coordinates for d3lndd1:

Click to download the PDB-style file with coordinates for d3lndd1.
(The format of our PDB-style files is described here.)

Timeline for d3lndd1: